Monoclonal anti Gelsolin
Monoclonal Anti-Gelsolin
clone 2E12, >99% purity
Cat. # 7305-01
............................................................................................................................................................................................................................................................
Description
|
|
Product name |
Monoclonal Anti-Gelsolin (clone 2E13) |
Target species |
Porcine cytoplasmic gelsolin |
Description |
Monoclonal anti gelsolin (99% purity) is an epitope mapped antibody that recognizes cytoplasmic gelsolin in humans and other mamals, and birds. Anti gelsolin 2E12 can be used to differetiate between cytoplasmic and plasma gelsolin. The antibody does not recognize plasma gelsolin, probably because the epitope is hidden by the N-terminal extension of the plasma gelsolin isoform.
As immunogen for monoclonal anti gelsolin2E12 cytoplasmic smooth muscle gelsolin was used and epitope mapping localized the following sequence (Fock et al., 2005): YGDFFTGDAYVILKTLGNECSQDESAAAI. Monoclonal anti gelsolin has been validated in immunofluorescence, immunoblot and ELISA |
Specification |
Immunofluorescence: 1:100-1:500, ELISA: 1:5000 |
Optical properties |
|
Properties
|
|
Form |
Freeze-dried. |
Quantity |
250 µg |
Content |
250 µg monoclonal Anti-Actin (clone 2E12) |
Clonality |
Monoclonal |
Isotype |
IgG1 |
Storage instructions |
Store as glyecrol stock at -20°C, Avoid freeze/thaw cycles. |
Remarks |
|
CAS no. |
For Use in Research only. Not for Use in Human or Veterinary Diagnostical or Therapeutical Processes. |
References
Østevold K, Meléndez AV, Lehmann F, Schmidt G, Aktories K, Schwan C.
Oncotarget. 2017 Sep 11;8(44):76686-76698. doi: 10.18632/oncotarget.20805. eCollection 2017 Sep 29.
Initiation of DNA replication requires actin dynamics and formin activity.
Parisis N, Krasinska L, Harker B, Urbach S, Rossignol M, Camasses A, Dewar J, Morin N, Fisher D.
EMBO J. 2017 Nov 2;36(21):3212-3231. doi: 10.15252/embj.201796585. Epub 2017 Oct 5.
{{.}}
{{/content}}{{{.}}}
{{/content}}